PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G310700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 200aa    MW: 21531.2 Da    PI: 8.7615
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G310700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.42.3e-11122184163
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         eke kr rr   NRe+Ar   +R++a  +eL++kv+ L++eN++ kke +   +e+ +lk  +
  Sevir.7G310700.1.p 122 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSSENETIKKEKDLVMEEYLSLKETN 184
                         89**********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.4E-13122186IPR004827Basic-leucine zipper domain
PfamPF001704.1E-10122185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.151124187IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-6126182No hitNo description
SuperFamilySSF579592.41E-7126182No hitNo description
CDDcd147021.09E-10127177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MSDDQQQHSG GQRQCRRGIT PDVELGAALA LADMAGSSVA QAKAARPAVQ QLRTAAAEEA  60
MTDDEEMAST RLSLQLGMVG IQSSSCSSGS SAGRPSRQLA PAPAAATGTH GPRPRHTLTE  120
AEKEAKRLRR VLANRESARQ TILRRQAIRD ELARKVADLS SENETIKKEK DLVMEEYLSL  180
KETNKQLKAE AHDLSLSLF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978331.11e-129PREDICTED: G-box-binding factor 1-like
TrEMBLK3YE221e-129K3YE22_SETIT; Uncharacterized protein
STRINGSi012481m1e-129(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.13e-17bZIP family protein